![jordan travel packages from dubai EN](https://cdn.travelwings.com/static/images/unitedkingdom.png)
- Democratic Republic of the Congo
- Guinea-Bissau
- Ivory Coast
- Saudi Arabia
- South Africa
- South Sudan
- United Arab Emirates
- United Kingdom
- United States
![](http://playon.fun/777/templates/cheerup/res/banner1.gif)
Jordan Packages
- Low to High
- High to Low
![jordan travel packages from dubai Easy Installments](https://cdn.travelwings.com/assets/images/redtick.jpg)
Exciting Jordan
![jordan travel packages from dubai Eternal Jordan](https://cdn.travelwings.com/assets/images/jordan-fit-sp-small.jpg)
Eternal Jordan
![jordan travel packages from dubai Ancient Jordan](https://cdn.travelwings.com/assets/images/amman-petra-jerash-fit-sp-small.jpg)
Ancient Jordan
![jordan travel packages from dubai Classic Jerusalem Jordan Tour](https://cdn.travelwings.com/assets/images/Jerusalem-and-Unforgettable-Jordan-sp-small.jpg)
Classic Jerusalem Jordan Tour
![jordan travel packages from dubai expert.jpg](https://cdn.travelwings.com/assets/images/expert-02Apr2022.jpg)
Jordan Holiday Packages
The Hashemite Kingdom of Jordan is an Asian country and lies at the crossroads of three continents – Asia, Africa and Europe. The nation has been home to some of the oldest civilizations in the world and that’s the reason it has been successful in making a mark on the global map. Whether it is the ancient city or Petra or Red Sea beach resorts, Jordan caters the best to its guests. Take our Jordan tour packages and set off on an expedition full of thrill. Our Jordan travel packages let you explore and experience the best of Jordan. So browse from our specially-curated Jordan holiday packages now.
Frequently Asked Questions (FAQs) About Jordan Tour
How to reach jordan.
The Queen Alia International Airport in the capital city of Amman is the main airport in Jordan and is served by airlines from across the world. It is well connected to places like Egypt, Italy, UK, Russia and other major places across the globe.
How to reach Jordan from the UAE?
You can take a direct flight from Dubai, Sharjah and Abu Dhabi. The average travel time of these flights is three hours.
What is the best time to visit Jordan?
March to May and September to November are the best times to visit Jordan. This is the time when spring and fall seasons occur respectively and hence, the weather conditions are decent. During these months, the days are warm and the nights are cool.
What are the main places to visit in Jordan?
Some of the major places to visit in Jordan include Petra, Dead Sea, Amman Ruins, Wadi Rum, Jerash, Aqaba and Mujib Nature Reserve.
What are the top things to do in Jordan?
Catch a glimpse of the Iconic Mount Nebo with your friends or explore the treats of Amman with your family. Go for a ride in the desert wilderness of Wadi Rum and look for ancient treasures in the rock-cut city of Petra. Explore the Roman architecture and also visit the thermal waterfalls of Ma'in Hot Springs.
What are some interesting facts about Jordan?
- The ancient Petra city in Jordan has a history of centuries and is one of the global destinations.
- Though Arabic is the official language in Jordan, English is often used for communication amongst the middle and upper classes.
- Olive is one of the common trees to be found in Jordan.
- Amman is one of the oldest cities in the Middle East with a history of more than 700 years.
What is the name of the currency of Jordan?
The currency of Jordan is the Jordanian Dinar (JOD).
You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- All-Inclusive Offers
- Early Booking Offers
- Europe Offers
- Indian Ocean Offers
- Last Minute Holidays
- Luxury Holidays
- Maldives Offers
- Umrah Offers
Featured Destinations
- Switzerland
- United Kingdom
- Philippines
- South Korea
- South Africa
Australasia
- New Zealand
Indian Ocean
- Czech Republic
- Antigua and Barbuda
- All-Inclusive Holidays
- Beach Holidays
- Business Class
- City Breaks
- Family Holidays
- Romantic Retreats
- Umrah Packages
- Costa Rica Tours
- Europe Tours
- Germany - Landscapes of Germany
- Jordan Tours
- Malaysia Tours
- South Africa Tours
- Sri Lanka Tours
- Tanzania - Best of Selous and Zanzibar
- Branch Location & Timings
- Pay My Balance
Jordan Explorer - Chauffeur-driven private car tour
Package inclusions:.
- Return Economy class flights on award winning Emirates
- 6 nights’ accommodation in 4-star hotels
- Return airport transfers by private car
- Meals, transfers and guided sightseeing tours as specified in the itinerary
- Entrance fees to Petra
- English speaking Local guide at Petra (from the Visitors Centre up to Qaser el Bint)
- Water on board the transportation vehicle
- Can be tailor-made to your preferences
Historical Jordan - Chauffeur-driven private car tour
- 3 nights’ accommodation in 4-star hotels
- Entrance fees to all sites mentioned above
Join the Emirates Holidays Community
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Holidays?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
- Enjoy rewards with Emirates Skywards
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
- +974 40415050
- [email protected]
- Georgia Tour Packages
- Switzerland Tour Packages
- Egypt Tour Packages
- Qatar Tour Packages
- Oman Tour Packages
- Bangkok Honeymoon Packages
- UAE Honeymoon Packages
- Sri Lanka Honeymoon Packages
- Maldives Honeymoon Packages
- Switzerland Honeymoon Packages
- London Family Packages
- Oman Family Tour Packages
- Doha Family Tour Packages
- Male Family Tour Packages
- Turkey Family Packages
- Doha Leisure Tour Packages
- Sri Lanka Leisure Tour Packages
Jordan Leisure Tour Packages
- Switzerland Leisure Tour Packages
- Turkey Leisure Tour Packages
![Jordan Leisure Tour Packages Jordan Leisure Tour Packages](https://c.regencyholidays.com/packages/e09a99e1-8a2a-4c5a-83c6-bee8750eeab4/original/3b8f589d-86ce-4caa-b0e2-0cc80bce6692.webp)
- 10 - 12 Days
Sitting in between Israel, Iraq and Syria, Jordan is said to be one of the rate stable enclaves that is on the UNESCO world heritage site list of places to explore. Occupying a great cut-out of the Arabian Peninsula, Jordan represents a deep history that goes back to the earliest humans and showcases its crumbling Roman cities, charm of the Ottoman, Persian treasures and Egyptian relics. So, as a part of the Jordan leisure tour package, people can explore the desert landscapes of Wadi Rum, the temple of Hercules and Dead Sea.
- Cab Facilities
- Airport pickup-drop
- Sightseeing
Showing 6 Jordan Holidays Packages
- Price Low to High
- Price High to Low
![9 Nights 10 Days Jordan Leisure Tour Package 9 Nights 10 Days Jordan Leisure Tour Package](https://c.regencyholidays.com/packages/0917fc55-2e06-4f70-bb1c-fdc688af550c/790X392/3fc1fa9a-e1ae-410f-a19c-1206645256bc.webp)
9 Nights 10 Days Jordan Leisure Tour Package
Experience the best of Jordan with the leisure tour package. Travel from the north to the south and enjoy the beautiful highlights of Jordan. Walk through the ancient rubbles and pathways, embrace the beauty of the deserts, and feel the warm welcome of the Jordanian people.
![6 Nights 7 Days Jordan Leisure Tour Package 6 Nights 7 Days Jordan Leisure Tour Package](https://c.regencyholidays.com/packages/faefd615-9219-4d8d-85b7-3ca9695f9f3e/790X392/f41ab2ba-fe13-4e26-99f0-ba9efe7468ec.webp)
6 Nights 7 Days Jordan Leisure Tour Package
This leisure tour package is specially meant for all those people who want to witness some of the world's most impressive sites as well as experience a serene and calming natural atmosphere. On this tour, get a chance to drive a 4x4 through the wadi rum desert valley and then get to spend a night at a Bedouin camp. Go for a swim in the Dead Sea, and visit the ancient Roman ruins in Jerash. Witness the mighty Mt. Nebo, observe the intricate designs of Kerak Castle, Ajlun Castle, Shobak Castle, Madaba’s Church of St. George, and visit the ancient Nabataean city of Petra.
![4 Nights 5 Days Jordan Leisure Tour Package 4 Nights 5 Days Jordan Leisure Tour Package](https://c.regencyholidays.com/packages/5e9f97a8-af4d-4e4d-a4e8-05df71311058/790X392/6567f2a1-a142-4593-a521-971d47095851.webp)
4 Nights 5 Days Jordan Leisure Tour Package from UAE
The 4 nights 5 days Jordan leisure tour package from UAE offers a glimpse of Jordan's rich culture and history. Highlights include exploring the ancient city of Petra, visiting the Dead Sea, experiencing the vibrant capital of Amman, and marvelling at the stunning desert landscapes of Wadi Rum.
![6 Days Jordan Leisure Package 6 Days Jordan Leisure Package](https://c.regencyholidays.com/packages/824a0c55-95d0-4336-a504-288141dfea79/790X392/75285e70-80c5-4f1e-8b1d-93d4f3a7ba7f.webp)
6 Days Jordan Leisure Package
One of the finest cut- out of the Arabian Peninsula, Jordan is seen nestled between Israel, Iraq and Syria. It is said to be a rare stable enclave of the region, one of the most stunning UNESCO world heritage sites and cultural hotspots. Jordan is said to have a deep history that goes back years, even before humans came into existence. The crumbling Roman cities, exquisite Ottoman charm, the Persian treasures and Egyptian relics are certain things to discover as a part of your 6 days Jordan leisure package .
![5 Nights 6 Days Jordan Leisure Tour Package 5 Nights 6 Days Jordan Leisure Tour Package](https://c.regencyholidays.com/packages/a3c7c64f-fbc8-4011-b93f-c2bd585a9d6d/790X392/82eafaab-588e-4bdc-89d1-5124b3a9a4e4.webp)
5 Nights 6 Days Jordan Leisure Tour Package from USA
Explore Jordan's rich history and stunning landscapes with the 5 nights 6 days Jordan leisure tour package from USA . Discover ancient ruins, swim in the Dead Sea, marvel at Petra's iconic red rock architecture, and more. This package includes accommodation, transportation, meals, and guided tours.
![8 Nights 9 Days Jordan Leisure Tour Package 8 Nights 9 Days Jordan Leisure Tour Package](https://c.regencyholidays.com/packages/b0b57e80-f8be-487c-bf05-803321a00830/790X392/94b81766-4d6d-4784-90b5-d6f8cf2dd510.webp)
8 Nights 9 Days Jordan Leisure Tour Package from UAE
Discover the stunning beauty and rich culture of Jordan with this amazing 8 Nights 9 days Jordan leisure tour package from UAE. Explore ancient cities like Petra, float in the Dead Sea, hike through scenic canyons, and indulge in delicious local cuisine. This tour promises a memorable experience in the heart of the Middle East.
One of the most stunning countries to visit is Jordan, which goes without saying. There is so much history, food and culture to imbibe. The Jordan leisure holiday offers several attractions to explore tucked away in each corner of the country. With so much history and culture, tourists should make it a point to visit the place at least once.
Top Places to Explore on Your Jordan Tour
When it comes to taking a vacation, Jordan is the one place that should be on everyone's bucket list. It is one of the most stunning places to explore for its ancient monuments, nature reserves and seaside resorts.
Said to be one of the most essential biblical relics found on the course of the Jordan river, Al- Maghtas is said to be butting up to the Israel- Jordan border on the eastern edge of the country. It is a one- stop tourist destination for Christians as it is said to be the place where Jesus Christ was baptized. A range of Jewish and Christian religious remains, Roman constructions and Orthodox monasteries are some of the spots people should explore as a part of their leisure tour package in Jordan.
Best Time To Visit: August
Tourists are in for a surprise at Amman, the biggest city to explore on Jordan tour . A pot of old and new flavors of the city has always ensured people come back for more. As one of the many places to explore, the treasure pot portrays its ancient culture in some of the modern buildings. The Roman Amphitheater, Jordan Museum, Jabal Amman and Abdoun are some of the place's tourists should ensure is a part of their Jordan leisure tour package.
Best Time To Visit: April
The northern hills of Jordan, Aljoun is said to be one of the untouched places that has yet to be explored. The historical town stands close to the old settlements that attracts tourists each year. The adventure enthusiasts are given a chance to hike up the old gateways and discover the castle’s interiors. With so much beauty, people should ensure Aljoun is a part of their Jordan leisure tour packages .
Best Time To Visit: March
Zarqa is one of the ideal places to discover the local Jordanian life, modern architecture and lively charm. Despite not flaunting its rural ruins, people are offered an experience of a life time at the lively bazaars and small teahouses. Known as the gateway destination to the Eastern desert, it was once a small village that grew in size after the Arab legion was established.
Best Time To Visit: August
The Roman era towns, Umm Qais sits on a high promontory with a view of Lake Tiberias, the Golan heights and Jordan valley. One of the most dramatic to explore, it is found sitting in the northwest corner of the kingdom that offers both white stone and black basalt as materials for buildings. It is a one stop tourist destination that should be a part of the Jordan leisure tour package.
Jordan Leisure Tour Packages FAQs
We have a team of some of the best agents in the world who can handle every need or demand customers have.
We believe in offering superior quality and nothing less.
We believe in 100% customer satisfaction. We are available 24 hours a day to solve all kinds of problems.
Jordan Tour Packages By Theme
You are using an outdated browser. Please upgrade your browser to improve your experience.
![jordan travel packages from dubai close](https://holidays.flydubai.com/system/img/cancel.png)
Please enter your details as they appear in your official travel documentation.
First name *
Middle name *
This field is mandatory
Last name *
Date of birth *
Nationality
Phone number
Email address
Confirm email address
Confirm password
By registering you agree to the terms & conditions of OPEN, rewards by flydubai.
By registering you agree to the terms & conditions of OPEN, rewards by flydubai.
Manage bookings
Enter your details to view or change your booking.
Holidays booking no. *
![Travel to Jordan Explore Jordan](https://holidays.flydubai.com/en/media/jordan-hero-image-2_tcm18-114184.jpg)
- Destinations ›
- Middle East ›
Ancient ruins, stunning views and sandy, rugged terrain as far as the eye can see make Jordan a truly unforgettable holiday destination. Through the ages, countless empires made Jordan its home, seeking control of its profitable trade routes. Now, the arid, golden landscape of this history-filled Middle Eastern nation hides archaeological gems in every corner of its vast territory. None, however, are more impressive than the ancient Nabatean city of Petra, carved out of the cliff faces of a rosy limestone gorge to provide a truly inspiring experience. This warm rose hue sprawls south towards Wadi Rum, an eerily silent desert of craggy canyons that bounce the sun’s rays while granting breath-taking views. As an escape from the heat and just a stone’s throw away from the country’s bustling capital, Amman, the Dead Sea appears as a salty oasis of tranquillity, with its health spas and luxury resorts.
Current weather in Amman
Jordan is best known for, good to know.
- Rates displayed here are indicative only and are subject to change.
- Travel Insurance
- Popular Destinations
Jordan Tour Packages
First Name*
Your message
Launching Soon
- Cherry Blossom Special
- National Day
- Christmas Special
- Eid Special
Jordan in a Nutshell - Summer
Best Holiday Packages from Dubai & Abu Dhabi
- Terms & Conditions
Introduction (60 minutes) -->
Experience the vibrancy of Jordan! we present you Jordan with breathtaking Historical sights, charming accommodations, and exquisite cuisine. Jordan, a place which once captivated ancient travelers, continues to enthrall a new generation with it’s eclectic mix of modernity and tradition.
Suggested Itinerary (60 minutes) -->
day 1: arrive amman.
Welcome to Jordan! Upon arrival in Amman, you will be met at the airport by your guide for a private transfer to your hotel (35km / approx. 45 mins). Standard check-in time at your hotel is 16:00. Overnight at Amman
Day 2: Amman Madaba – Nebo – Shobak – Petra
This morning drive out of the city to Madaba (38km / approx. 45 mins). Madaba, otherwise referred to as the ‘City of Mosaics’ is best known for its collection of Byzantine-era mosaics. The most famous of these is the mosaic map of Jerusalem and the Holy Land which can be found on the floor of St George’s Church. Continue with a visit to Mount Nebo, one of the most important biblical sites where it is believed that Moses first sighted the Holy Land. A small Byzantine church was built on the site by the early Christians and has since been expanded into a vast complex. During his visit to Jordan in 2000, Pope John Paul II held a sermon here that was attended by over 20,000 people. Your final stop today is a visit to Shoubak castle (240km / approx.3 hrs.’). Perched on a rocky hilltop, this imposing fort was built by the Crusader King Baldwin I of Jerusalem in AD 1115 to guard the road linking Syria and Egypt — the old King’s Highway. It successfully withstood numerous sieges until it fell to Saladin's troops in 1189. Enjoy a wander around the remains of this old castle and admire the spectacular views across the barren landscape. After finishing your sightseeing tour continue with the drive to Petra (30km /approx. 30mins) arriving late afternoon. Meal: Breakfast
Day 3: Visit Petra – Dead Sea
This morning enjoy a guided tour around one of the world's most famous and awe-inspiring archaeological sites – the UNESCO World Heritage Listed ancient city of Petra. Start by entering through the Siq, a long and winding narrow gorge flanked on either side by soaring 80m high cliffs which will lead you to the breathtaking façade of The Treasury (AlKhazneh). The Treasury is arguably one of Jordan’s most iconic wonders and was featured in the film ‘Indiana Jones and the Last Crusade’. Spend some time exploring the city’s main highlights including the Roman Theatre, Street of Façades and the Royal Tombs. This afternoon is free for you to explore the vast network of hidden passages and fascinating tombs and palaces at your leisure. You may wish to climb up to the High Palace of Sacrifice which is located at the summit of the Attuf Ridge and offers spectacular views over the red sandstone landscapes of Wadi Araba. Or perhaps head to the Monastery, one of the largest monuments in Petra boasting an impressive façade measuring 47m wide and 49m high (please note this climb involves around 800 steps). This afternoon you will be transferred to your Dead Sea resort. (200kms/approx. 3 hrs.’). Enjoy a day at leisure at the lowest point on earth. Why not try out the mud baths, claimed to have therapeutic qualities and float in the mineral rich waters. Meal: Breakfast
Day 4: Dead Sea - Depart Amman
Today you will be transferred to Amman airport (50km / approx. 1hr) for your onward flight. Standard check-out time at your hotel is 12:00. Meal: Breakfast
- 1 Night accommodation at Ambassador hotel - 4* (Standard Room) OR similar in Amman
- 1 Night accommodation at Petra Moon hotel - 4* (Standard Room) OR similar in Petra
- 1 Night accommodation at Dead Sea Spa Hotel - 4* (Standard Room) OR similar in Dead Sea
- Daily breakfast
- Meet and assist at the airport
- All transfers using modern vehicles
- Entry fees to the mentioned sites
- Local English-speaking guide in Petra
- Travel Insurance
- Airfare & Visa Charges
- City Tax to be paid on the spot at the hotel
- Optional Sightseeing’s
- Tips and porterage
- Meals other than specified in the itinerary & Drinks including Water during meals
- Any expenses of personal nature
- Any services not mentioned in the inclusions list
PRICING: (Validity 1st Jan 2024 – 30th Dec2024)
*Prices are Indicative and may subject to change at the time of booking.
Terms & Condition:
- Above is only a quotation. No reservations are being held
- All rates and confirmations are subject to availability at the time of booking
- Special requests are subject to availability at the time of Check in
- Rates are in AED based on current rate of exchange
- Rates are subject to change without prior notice or due to events beyond our control
- Rates are not valid during Peak dates (Eid & Any Long Weekends)
- Please check the visas requirements for the countries visiting
- Please check the names given as per the passports to avoid inconvenience/offloading
Jordan in a Nutshell - Spring
Jordan in a nutshell - winter.
On Arrival in Amman, meet at Amman Airport and transfer to hotel. Check-in at 1400 hrs (breakfast not included). The rest of the day is free for leisure. Overnight at Amman.
Day 2:Amman – Madaba – Mount Nebo – Karak – Petra
After breakfast transfer to visit on the way Madaba the city of Mosaics, which has the oldest known mosaic map of the holy land, after that we will go to view the Jordan Valley from the famous Mount Nebo visiting its Byzantine Church . Afterwards continue to Kerak touring its Castle one of the finest examples of Crusader military construction, Transfer to Petra. Overnight in Petra. Meal: Breakfast
Day 3: Petra visit – Dead Sea
After breakfast – transfer to Petra, Full day visiting the rose-red city known as Sela in the Bible and lost to the world for five centuries until it was rediscovered in 1812. Enter Petra on horseback through a narrow gorge carved in the sandstone and opening on the stunning view of the Treasury, made famous in the movie “Indiana Jones and the Temple of Doom”. Visit the palace, the High Palaces and the Roman-Style Palace Tomb , then proceed to Dead Sea, visit the Dead Sea which is the lowest point on earth 400 meters below sea level. Overnight at Dead Sea hotel.
Check out and transfer to Amman Airport Meal: Breakfast
- Local English speaking guide in Petra
Pricing: (Validity 1st Oct 2023 – 31st March 2024)
*Price is applicable based on minimum 4 passengers travelling together.
- Rates are not valid during Peak dates (National Day, Christmas & New Year)
Jordan in a Nutshell - National Day
Jordan in a nutshell - christmas day, jordan in a nutshell - eid, jordan in a nutshell - weekend day, jordan in a nutshell.
Search according to season...
Jordan in a Nutshell - Cherry Blossom Special
Explore more customized tour packages from dubai.
You will receive an email containing a link allowing you to reset your password to a new preferred one.
Business Solution
![jordan travel packages from dubai whtsapp-icon](https://www.sharaftravel.com/Content/Site/imagescustomize/whtsapp-icon.png)
Why having an account is great for you
Get access to exclusive deals, earn and redeem Wallet points, save travellers’ details for quicker bookings and manage your upcoming bookings with ease!
By creating an account, I acknowledge that I have read and agree to Sharaf Travel Terms & Conditions and Privacy Policy.
Create an account
- Forgot your password?
If you are having difficulty logging in, you can reset your password by typing the Email Address that you used while registration. You will receive an email with a new password.
Amman Trip for 4 days
![jordan travel packages from dubai](https://www.sharaftravel.com/Uploads/CMS_Image/Package/Origin_638143875049797293.jpg)
Amman is the capital and most important city of Jordan all around. The city is located in the western part of the Jordan and 100 kilometers away from Jerusalem.
Duration 3 Nights 4 Days
Validity 06-04-2022 To 30-09-2024
Destination Jordan
- About Jordan
- A Must See and Try
JORDAN PACKAGE INCLUSIONS
- Economy class return air ticket with airport taxes
- 3 Nights’ accommodation in mentioned Hotel Days Inn by Wyndham Hotel Suites or Similar in Amman 4* on twin sharing basis
- Daily Breakfast
- Half day Amman city tour on sharing basis
- Return Airport transfers on sharing basis
- Pandemic Coverage Travel Insurance
FLIGHT DETAILS - Fly Dubai
FZ 143 DUBAI AMMAN 1920 2135
FZ 144 AMMAN DUBAI 2235 0235
TERMS & CONDITIONS
- Price doesn’t include any other services not mentioned.
- This offer can be withdrawn anytime without any prior intimation
- This offer is subject to availability and not valid during blackout periods
- City Tax (if any) is payable directly.
- The tour starts from a city center point, transportation to and from the hotel is not included
DAY 1 : ARRIVE IN AMMAN
Welcome to Jordan!
On arrival, you will meet our representative and transferred to your hotel in Amman.
As Middle Eastern cities go, Amman is a relative youth, being mostly a creation of the 20th century. But though it lacks the storied history and thrilling architectural tapestry of other regional capitals, there’s plenty here to encourage you to linger awhile before making for Petra, the Dead Sea or Wadi Rum. In fact, Amman is one of the easiest cities in which to enjoy the Middle East experience.
Overnight in Amman.
DAY 2 : HALF DAY AMMAN CITY TOUR (SHARING)
Take a fascinating trip through old and new Amman, and soak up its rich heritage and culture, while indulging in the 21st-century luxuries Jordan’s bustling capital city has to offer.
We start by strolling through the annals of Jordanian history with enriching visits to the Citadel, the Archaeological Museum and the Folklore Museum, before heading to the Hashemite Plaza and visiting one of the city’s most outstanding ancient sites, the remarkably well-preserved ruins of the majestic Roman Amphitheatre. We then drive along the tree-filled avenues of the city’s residential area to gander at the typical white houses, made of local stone, before stopping at the downtown area, much older and more traditional, where small local businesses produce and sell everything from sparkling jewellery to household items. The welcoming people in this vibrant city are the cherry on top of a tour that is sure to amaze.
Note: This product includes transfers from and to your hotel.
Duration: 2 and a half to 3 and a half hours
Approximate start time: 08:30 hours.
Note: Transfer pick-up from and to your hotel is in a private vehicle, while excursion/activity is on shared basis
DAY 3 : DAY AT LEISURE
After Breakfast.
Day at leisure, to explore Amman City on your own.
You can select your day out of many activities available on an optional basis.
DAY 4 : DEPART AMMAN
After breakfast, Check out from hotel.
You will be transferred to the airport in Amman for your onward journey/back home.
We trust that you enjoyed your vacation and returning with beautiful memories.
END OF THE SERVICES
From the ancient city of Petra to the breathtaking Dead Sea and sublime desert landscapes of Wadi Rum in between, Jordan has delighted visitors for centuries.
Capital City
Amman is the capital and most important city of Jordan all around. The city is located in the western part of the Jordan and 100 kilometers away from Jerusalem. Amman is one of the oldest cities in the world dating back to 7300 BC. The city always held great importance for many empires throughout history. All of its rulers left remarkable monuments that now attract millions of tourists especially from Europe and Arabic countries every year. Amman is steadily growing to be the top historic tourism destination of the Middle East.
- Jordan Local Currency is Jordanian Dinar.
Best Time to Visit
- March to May or September to November are the best time to go to Jordan.
A Must See Attractions in Almaty
- High Place of Sacrifice
- Shaumari Wildlife Reserve
A Must Try Food
- Barbeque and Mezzah
Easy and Fast Booking
Secure Payment
24X7 Customer Support
Congratulations! You found a great deal today!
Please wait while we transfer you to...
Signup for Newsletter
![jordan travel packages from dubai jordan travel packages from dubai](https://www.sharaftravel.com/Content/Site/imagescustomize/f1.png)
- Holiday Packages
- Corporate travel
- Job Opportunities
- Dos & Donts of UAE
- Sharaf Holidays
- Sharaf Tours
- Airline & Leisure
- New World Travels
- Sharaf Group
- News & Updates
- Trending Searches
![jordan travel packages from dubai footer-logo](https://www.sharaftravel.com/content/site/imagescustomize/footer-logo.png)
![jordan travel packages from dubai Sherazade Travel](https://www.sherazadetravel.com/templates/yootheme/cache/6a/logo-color-black-text-min-6a8c1ec2.png)
- Jordan Highlight Plus 5 Days And 4 Nights
- Jordan Highlights 5 Days And 4 Nights
- Jordan Classic Tour 7 Days And 6 Nights
- Glance Of Jordan 4 Days And 3 Nights
- Petra Weekend Tour 3 Days And 2 Nights
- Biblical Jordan 8 Days And 7 Nights
- Jordan Beauty 9 Days And 8 Nights
- Jordan & Jerusalem Tour 8 Days And 7 Nights
- Jordan Culture Tour 6 Days And 5 Nights
- Jordan Classic Plus 8 Days And 7 Nights
- Jordan’s Treasure 4 Days And 3 Nights
- Tailor Made Tour Craft Your Private Trip
- Day Trips and Excursions Tours
- Self Driving - Car Rental
- Desert Castles
- Baptism Site
- Dana & Feynan
- Blogs and Activities
- General Information ONBOARDING ,TRAVEL TIPS, FAQ
- Hotels & Accommodation Hotels & Accommodation
- Jordan Weather and Climate Weather & Climate in Jordan
Jordan Tours from Dubai
Travel to jordan from united arab emirates.
![jordan travel packages from dubai wadi rum](https://www.sherazade-jordan.com/wp-content/uploads/2017/10/Jordan-tours-from-dubai-300x200.jpg)
Jordan Tours organizers knew in the domain of organizing and delivering outstanding service from helping tours organizations and travelers, from Dubai itinerary until Amman, your Dubai to Jordan trip will be memorable than you expected. The tours to Jordan from Dubai depart daily of more than 6 flights from Dubai International Airport to Amman. The flights are for less than 3 hours and offer a great value and great comfort. In Amman, you will meet With various Jordan Tours available in the Amman arrival. The tours of Jordan can even be arranged directly from Dubai then in Amman, you will be received by your tour agency to your Hotel. Whether from Dubai directly or in Amman, you are sure to find a tour which meets your requirements. Petra is Jordan’s main highlight, Other popular sites include Wadi Rum, the incredible desert landscape made famous by Lawrence of Arabia, Jerash, the impressive Roman city, and Amman, Jordan’s bustling capital.
Jordan-tours-from-dubai
Flight from Dubai International Airport to Amman
Did you know that Dubai International Airport is the primary international airport serving Dubai, United Arab Emirates and is the world’s busiest airport by international passenger traffic? For that reason, when you plan your trip to Amman(Jordan), daily you have more than 6 flights to Queen Alia International Airport or to Amman Marka International.
Amman And Tours Meeting
From Dubai to Amman, you have two choices or flights. Whether you want to land into Queen Alia Internationa l or to Amman Marka International . Whatever airport you choose you will always be met with your trip or tours organizers. The best way is to find the cheapest flights or to arrange with your tours guides and choose together the best airport to land. The most important in Jordan Tours organizers is wherever you landing, they are able to pick you up. There you have different type of tours depending on your days number of staying in Jordan
![jordan travel packages from dubai jordan travel packages from dubai](https://www.sherazadetravel.com/media/plg_system_nrframework/img/flags/us.png)
![Wadi Rum Desert Red Mars like landscape in Wadi Rum desert, Jordan](https://images.goway.com/production/hero/iStock-1281287664.jpg)
Jordan Vacations
Exploring the treasures of jordan.
In the heart of the Middle East, Jordan stands as a land of captivating contrasts and exceptional natural beauty. Surrounded by countries like Iraq, Syria, Saudi Arabia, and Israel, Jordan's diverse landscape offers a multitude of experiences for travellers. Jordan Tours are an incredible way to explore this amazing nation. From the spellbinding ruins of Petra, a UNESCO World Heritage site, to the surreal deserts of Wadi Rum, where you can step into otherworldly landscapes, Jordan promises a journey through time and wonder. Explore ancient Nabatean cities, Roman archaeological sites, and Crusader castles. Experience the dramatic canyons and winding wadis that tell stories of history and nature intertwined. Beyond these natural wonders, Jordan's cities, like the bustling capital, Amman, and the tranquil coastal town of Aqaba, provide a harmonious blend of modern life and tradition. You'll encounter the warm embrace of Jordanian hospitality as you savour the local cuisine, immerse yourself in lively markets, and unravel the tales behind ancient architectural wonders. Jordan invites you to join us on a voyage of exploration and amazement as we reveal the secrets and splendour of this captivating nation.
![Explore the ancient town of Petra, with intricate caves carved from the surrounding rock Explore the ancient town of Petra, with intricate caves carved from the surrounding rock](https://images.goway.com/production/styles/visual_media_content_3xl/s3/geopages/country/an_ancient_cave_town_placed_in_jordan_1.jpg?itok=8EB2jrI4)
Handcrafted Journeys to our Most Popular Places in Jordan.
![jordan travel packages from dubai Temple of Hercules located on Amman Citadel in Amman, Jordan](https://images.goway.com/production/styles/hero_s1_teaser_20_23_3xl/s3/hero/iStock-1314168782.jpg?VersionId=IBsxB2byibw6LieSUOpoJumZ8sUXzAl1&itok=vJ_p66xD)
Jordan: A Journey into History and Wonder
Ancient wonders and breathtaking landscapes define Jordan. Explore the lost city of Petra, traverse the Martian-like terrain of Wadi Rum, and dive into the crystal-clear waters of the Red Sea. A rich history and vibrant culture await in Amman and Aqaba. With its captivating blend of the ancient and modern, Jordan offers an adventure like no other.
![jordan travel packages from dubai Ancient and roman ruins of Jerash (Gerasa), Jordan.](https://images.goway.com/production/content-highlight/2024-02/iStock-1163715964.jpg)
The Culture
Jordan's culture is a rich blend of traditions characterized by warm hospitality and a profound connection to its historical heritage. Jordanians are renowned for their cordiality, creating an inviting atmosphere for travellers.
In Jordan, formal greetings are a customary aspect of interactions. Expressing "Marhaba" (hello) and "Salam" (peace) when entering homes or shops is not only polite but deeply ingrained in the culture. Hospitality is highly esteemed, and guests are treated with the utmost respect. Offering tea or coffee as a sign of hospitality is a common practice, and it's considered impolite to decline.
The culture in Jordan is a harmonious fusion of various influences due to its historic role as a crossroads of civilizations. Arabic is the official language, but English is widely spoken, particularly in urban areas and among the younger generation. Jordan's population is predominantly Muslim, with a substantial Christian minority. However, the nation is home to a variety of other religious and ethnic communities, including Circassians and Bedouins. This religious diversity enriches the cultural landscape of Jordan.
Traditional attire remains an integral part of Jordanian culture. Jordanian men frequently wear the dishdasha (a long robe) and head covering, while women may be seen in the abaya or hijab. In urban areas, Western-style clothing is also prevalent.
Jordan's traditional music and dance forms, including dabke, serve as expressions of cultural heritage. These performances frequently accompany celebrations and special events, uniting people through music and rhythmic movements.
The Best Time to Visit
Jordan offers diverse experiences year-round, making it a captivating destination for every season. Spring (March to May) is arguably the best time to explore Jordan. The weather is mild and comfortable, with temperatures ranging from 15°C to 25°C (59°F to 77°F) in most areas. The landscape comes alive with blooming wildflowers, and outdoor adventures like hiking and exploring ancient ruins are particularly enjoyable during this season. Spring is perfect for a visit to Petra or embarking on a desert adventure in Wadi Rum.
Summers (June to August) in Jordan can be hot, with temperatures often soaring above 30°C (86°F) and even higher in the desert regions. While it's a great time for water activities in the Red Sea and the Dead Sea, it's advisable to stay hydrated and seek shade during the scorching midday sun. If you plan to explore Jordan's northern regions or the cooler hills around Amman, the heat is more manageable.
Autumn is another excellent time to visit Jordan, especially in September and October. The weather remains pleasant, making it ideal for outdoor excursions. The colours of the landscape begin to change as fall sets in, creating a picturesque backdrop for your adventures. The start of autumn is also the perfect time to experience Jordan's vibrant local culture and traditions.
Winter (December to February) in Jordan is relatively mild, but the temperature can drop, particularly in higher elevations like Petra. While it may not be suitable for swimming in the Red Sea, it's an excellent time for exploring historical sites and enjoying urban experiences in cities like Amman. Some travellers appreciate the cooler weather for their outdoor adventures in the desert as long as they are prepared for chilly nights.
Things to Know
How to plan a trip to jordan.
Most Jordan tours fly in and out of Amman, the nation’s capital, thanks to its plentiful air connections. From there, it’s possible to see the highlights in just over a week. Petra and the deserts of Wadi Rum are Jordan highlights for any first-time visitor, but a week in Jordan gives you time to add the Roman city of Jerash, the Dana Biosphere Reserve, and some relaxation by the Dead Sea to your Jordan trip. With more time, spend a few days in Aqaba, relax by the beach and snorkel the reefs of the Red Sea.
How long can I stay in Jordan?
A visa issued on arrival in Jordan is good for 30 days.
What currency does Jordan use?
Jordan uses the Jordanian dinar which trades around .7 to $1 USD.
How much is a trip to Jordan?
A Jordan tour can be done quite affordably, but for a proper immersion into this unique country, budget around US $345 per person, per day.
Do I need to tip in Jordan?
Baksheesh is not as prolific in Jordan as it is in many parts of the Arab world. A small tip is customary for good service at hotels and restaurants, and for drivers and guides. Ten percent will normally be enough.
Should I bargain in Jordan?
Be sure to bargain in Jordan’s markets. A fair price is usually 60 percent of the seller’s initial ask. You should also confirm prices with your cab driver before setting out. Don’t try to bargain in hotels, restaurants, or other businesses with fixed prices.
What to pack for a trip to Jordan?
Good walking shoes and light, breathable clothing will save you a lot of discomfort in Jordan. Make sure what you pack (except for beachwear) covers your shoulders and legs. While renowned for its deserts, Jordan is a diverse landscape. Its winters can be chilly and rainy, so a light waterproof jacket is a good idea during these months, as well as a few light, breathable layers.
What is Jordan’s famous food?
There’s no dish more Jordanian than mansaf , a delicious platter of lamb, rice and fermented yogurt often topped with parsley, nuts and lemon. Ka’ak is a sesame covered bread that will ruin you for all other pita, and it’s worth persevering with makmoura to get at the meaty goodness inside that crisp pastry. For delicious and authentic barbecue, look no further than the tender meats falling off the bone at a Bedouin zarb . Kanafeh offers a cheesy sweet treat at any time of day, and of course you’ll find regional staples like hummus, labeneh , and baklava .
How safe is Jordan for female tourists?
Jordan is generally more liberal than its neighbours and is considered one of the best introductions to the region for solo female travellers. A few precautions will keep you out of trouble, however. Don’t walk at night on your own and try to ignore offers of help or tours from strangers. Jordanians tend to be genuinely friendly and curious, but err on the side of caution if anything feels off. There is no strict dress code for women in Jordan (beyond covering shoulders and knees, which also applies to men), though some religious spaces may be more conservative.
Is Jordan LGBTQ+ friendly?
Again, breaking with its Arab neighbours, Jordan legalized homosexual acts in 1994. There are also some provisions for gender confirmation and Amman supports a small but active LGBTQ+ scene. However, public attitudes are extremely conservative. LGBTQ+ tourists are welcome in Jordan, but be discreet if you’re not around people you know. Public displays of affection are frowned upon regardless of orientation. Any men you see holding hands are most likely expressing friendship, not romantic affection.
Is the tap water safe to drink in Jordan?
Jordan’s tap water meets safety standards for drinking, but due to water shortages it can taste a little odd, so many visitors prefer bottled water. There is no recycling program to speak of in Jordan, so a reusable bottle and purification tablets are often a better option. For other purposes such as bathing and brushing your teeth, tap water will do fine.
What to know when visiting Petra?
The Nabataean city of Petra is Jordan’s star attraction, and ever-increasing tourist numbers have not dulled its sense of majesty and wonder. The best times to visit are during the shoulder seasons, March to May or September to November. The relatively quiet winters can also be a good time if you don’t mind the cold (down to 36°F [2°C]). Petra opens at 6am year-round, closing at 6pm in summer and 4pm in winter. Several nights a week, a Petra by Night experience illuminates the Siq and Treasury with candles, offering a completely new way to appreciate the Rose Red City. The site is much bigger than most visitors expect, so for a deep dive into its history with time to see the lesser-known sites, consider staying an extra day or two.
![](http://playon.fun/777/templates/cheerup/res/banner1.gif)
Food & Drink
Jordanian food is a feast for the senses, reflecting the country's rich history and cultural diversity. Mansaf is considered the national dish and is a hearty and aromatic feast. A traditional Bedouin meal, it features tender lamb cooked in fermented, dried yogurt, served over a bed of rice and flatbread. Mansaf is often enjoyed during festive occasions, embodying Jordanian hospitality.
Mezze is a delightful array of appetizers that kickstart any Jordanian meal. From creamy hummus and smoky baba ganoush to stuffed grape leaves (warak enab) and crispy falafel, mezze offers a symphony of flavours.
Grilled meat is a culinary art in Jordan. Kebabs, whether made with succulent lamb, beef, or chicken, are seasoned with aromatic spices and served with fragrant rice or flatbread.
Jordanians take pride in their tea and coffee traditions. Enjoy a cup of sweet mint tea, a popular choice, or savour the strong and cardamom-infused Arabic coffee (gahwa) served in small cups with a side of dates.
Arak is an anise-flavoured alcoholic beverage that is a traditional choice for those seeking a taste of Jordanian spirits. Diluted with water and often enjoyed with mezze, arak adds a unique touch to social gatherings.
End your meal on a sweet note with Jordan's delectable desserts. Kunafa, a pastry filled with sweetened cheese or nuts, and baklava, layers of phyllo dough with honey and nuts, are irresistible treats.
Get Inspired About Jordan.
The experts in tailor-made travel.
When working with Goway, you dream it, we plan it. Rely on the passion and expertise of our Destination Specialists to craft the trip that’s right for you.
![jordan travel packages from dubai Middle East](https://images.goway.com/production/styles/contact_cta_image_3xl/s3/contact_cta/Middle%20East%20-%20AdobeStock_286019755.jpeg?VersionId=KgaIY5Ozm0pCCnQ73bFHYigoiEYIjb15&h=fd821441&itok=CtLIG7xD)
- +971 56 470 7711
- [email protected]
![jordan travel packages from dubai jordan travel packages from dubai](https://www.sabsanholidays.com/wp-content/uploads/2020/12/Sabsan-Logo.png)
- Your cart is empty
Jordan Tour Package
from 1 review
3 Nights / 4 Days
If you need an escape from the hurry buries of the city life, then no other country could be better than Jordan. Tourists from all over the world flock to Jordan for having a peaceful vacation. However, there are plenty of attractions in Jordan such as Wadi Rum, Amman, Dead Sea, Petra, Siq, High Place of Sacrifice, Amman Citadel and much more. You can explore all these places by signing up with Sabsan Holidays for the Jordan tour package from Dubai.
Places to visit in Jordan
If you are looking for one reason to visit Jordan, “Petra is one of the seven wonders in the world.” There are plenty of reasons to visit Jordan, and we are listing them below. Have a look at the place to visit in Jordan
Let us start with the seven wonders of the world. Petra comes on the list and is the main reason for a lot of tourists around the globe to visit Jordan. It is a fantastic place in Jordan which is worth visiting. You can take a stroll around the stunning canyons, ancient carved temples, and see the incredible sites such as the Treasury, El Deir and the Great Temple. The place is an amazing destination on the planet.
The place is blessed with scenic beauty that lures tourists from all over the world. Mount Nebo is a sacred place where Moses was granted a view of the Promised Land. The place has a fantastic view, and on bright days you can even see Israel border.
Being a country in the Middle East, Jordan, of course, has desert regions. One such desert area is Wadi Rum which is filled with golden dunes, rock formations, and small desert camps. You can explore this place and have a sleepover in the desert. But make sure that you wear warm dresses.
The dead sea is one of the most exciting spots in the world and is located in Jordan. You can float freely in this sea due to its high salt content. The sea is surrounded by amazing resorts and spa, hence making it a fantastic spot for you to stretch and relax.
Jerash is the country’s well preserved Roman city. The place owns a lot of ancient ruins. You can explore the temple of Apollo, Hadrian’s Arch, the Forum complete with its semi-circle of ornate columns, and the finely preserved Roman Amphitheatre in Jerash.
The capital city of Jordan, Amman is a mandatory visit during your trip to this country. It is a city with a blend of new and old with the relics of the past and soaring skyscrapers. There are plenty of places to explore in Amman such as the ancient Citadel, the King Abdullah Mosque, and the Jordan Museum. Moreover, stroll around the streets and markets to get the essence of the Jordanian lifestyle. You can also explore Abdali, where leafy avenues give way to chic cafes and high-street boutiques.
Though Jordan is a Muslim country, it is liberal in all ways. You can wear any dress in Jordan, but make sure that you are appropriately covered for a comfortable trip.
Explore the fantastic underwater world of Jordan by doing snorkeling in the red sea. Aqaba is the only coastal city of Jordan, and it is located near to the red sea. If you are a beach person, you can explore this city with a lot of large ports, beautiful hotels, and ancient archaeological sites.
If you are looking for a tour package to Jordan from Dubai, then call us!
FAQ about Jordan Tour Package from Dubai
- Is it safe to travel to Jordan? Jordan is one of the safest countries in the world. It maintains a perfect relationship with the neighboring countries and is fairly liberal and westernized. Also, free alcohol is available everywhere.
- What is the voltage? The electricity is 220 volts, so bring along a transformer if you need one.
- How active is the communication system in Jordan? Jordan has a fantastic communication system with three mobile networks; you can even buy prepaid GSM cards. You can also find internet cafes everywhere. Apart from that, the hotels of Jordan has wifi facility.
- What should I wear in Jordan? Even though Jordan is a Muslim country, it is not a conservative one. You can wear whatever you want, but it is better to cover your body when you are in Amman city center. Weather in summer is really harsh so make sure you take a hat, sunblock, and comfortable walking shoe. Take your warm jackets when you are traveling to Jordan during winter since winter can be very cold.
- What is the official currency of Jordan? The Jordanian Dinar is the official currency of Jordan.
- Is it safe to drink tap water? Tap waters are safe but salty and not particularly pleasant in Jordan. But most of the people prefer drinking bottled water because the purification system doesn’t eliminate the slight percentage of chlorine in the water.
- Should I tip in Jordan? Tipping in Jordan is appreciated but not compulsory.
For Jordan Tour Package from Dubai bookings
Call us +971-6-7420334 (or) Email: [email protected]
Day 1: Arrival Amman Airport
Upon arrival you'll be met our Tours Representative who will assist you through immigrations and customs, and he will escort you to your hotel. Overnight stay at hotel.
AT Early Morning transfer to a full day dedicated visit of the lost Nabteans city of Petra. Start with a morning ride on a Bedouins guided horse; you'll pass through fabled SIQ, immense sandstone, which opens out to reveal the treasury. Continue on to see hundreds of ancient Temples, Royal Tombs, Roman theatres and houses. After Petra Visit Drive back to Amman, & Overnight stay at hotel.
Breakfast, then depart Wadi Rum and You'll stop at the Byzantine Church of Mt. Nebo, and then proceed to Madaba where you will see a unique Mosaic Map of Palestine, then Drive down 400 meters below sea level and experience an unforgettable swim at the salty waters of the Dead Sea. Free day at Dead Sea A hyper saline lake is a landlocked body of water that contains significant concentrations of sodium hloride or other mineral salts, with saline levels surpassing that of ocean water. 3. With 33.7% salinity, the Dead Sea is one of the world's saltiest bodies of water. Drive back to Amman & Overnight stay at hotel.
Enjoy a tasty breakfast and complete the hotel check-out. Transfer to Amman airport for departure
Included/Excluded
- 03 Night stat at Amman on double sharing basis
- Accommodation on 3* Hotels with Breakfast
- Meet and assist at Amman Airport upon Arrival & departure.
- Sightseeing in modern air-conditioned private transfer
- Entrance fees to all sites mentioned at the excursion
- Local English Speaking Guide at Petra for 02 – 03 Hours only
- Return airport transfers on a private basis
- Applicable taxes
- Visa, Travel insurance if any
- Personal expenses, such as phone calls, laundry, souvenirs, etc., tipping at restaurants, drivers and guide (at client’s discretion)
- Photographic permits place of interest for the video and cinema cameras portage & restaurant tips
- Early check-in and late check-out charges
- Admission fees or activities not mentioned in our itinerary
Tour's Location
Write a review
Leave a review cancel reply.
Your email address will not be published.
You might also like
![jordan travel packages from dubai jordan travel packages from dubai](https://www.sabsanholidays.com/wp-content/uploads/2020/01/Malaysia-tour-package-from-Dubai-800x600.jpg)
Malaysia Tour Package
![jordan travel packages from dubai jordan travel packages from dubai](https://www.sabsanholidays.com/wp-content/uploads/2020/01/kanyakumari-tour-packages-from-dubai-800x600.jpg)
Kanyakumari Monsoon Resort Stay 2N / 3D
![jordan travel packages from dubai jordan travel packages from dubai](https://www.sabsanholidays.com/wp-content/uploads/2020/01/Kerala-Ayurveda-Rejuvenation-uae-800x600.jpg)
Kerala Ayurveda Rejuvenation Packages
![jordan travel packages from dubai jordan travel packages from dubai](https://www.sabsanholidays.com/wp-content/uploads/2020/01/pigeons’-Rock-lebanon-800x600.jpg)
Lebanon Tour Package
Enter the e-mail address associated with the account. We'll e-mail a link to reset your password.
![jordan travel packages from dubai Vacations in Jordan](https://content.r9cdn.net/rimg/dimg/f6/3c/8e9a78d7-city-63641-168867a1eb7.jpg?width=1366&height=768&xhint=2244&yhint=2201&crop=true)
Vacations in Jordan
Search hundreds of travel sites at once for vacation package deals in jordan.
Free to use There are no hidden charges or fees.
Filter your deals Filter by free cancellation, free breakfast and more.
Millions of reviews Check ratings based on millions of real guest reviews.
Bundle and save Save money when you bundle your flight + hotel.
Cheap Jordan package deals
Most popular jordan flight and hotel deals, search by stars, search by review score, search by board, search by price, search by freebies, when to book a vacation in jordan, tips for finding jordan package deals.
- There are loads of types of vacations in Jordan and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $412; Family vacation $320; Romantic vacation $503; Luxury vacation $544.
Where to stay in Jordan
Jordan vacation information, popular package vacation destinations in jordan.
![jordan travel packages from dubai Luxor and Aswan Travel](https://www.luxorandaswan.com/logo/logo2.png)
Jordan Travel Packages
Relish the best of Jordan tour packages, which offer plenty of travel tour packages to Jordan, where you will explore the charm and beauty of this ancient civilization land and tailor-make your Jordan Vacation Package. There are countless things to do: Tours from Amman will take you to legendary ‘rose-red’ city of Petra , carved into the stone of the Jordan desert, the treasury, the siq, the enterance, the Roman Jerash the best example of a Roman provincial city in the whole Middle East, Float in the Dead Sea salty water, Ajloun, Mount Nebo the place where Prophet Moses gazed at the promised land, Madaba, where you see the famous 4th-century Byzantine mosaic map of Jersaleum inside the Greek Orthodox Church of St. George and more awaiting for you!.
If you seek a peace of mind and relaxation where you will experience the ultimate joy, you may add to one of your favourite Jordan Vacations "camping tour at Wadi Rum" to enjoy an evening under the stars experiencing a fantastic desert camp. or beach holiday in amazing Aqaba. All of these things will make your tour of Jordan Packages an unforgettable one and leave you breathless.
With all that this captivating country has to offer, discover Jordan 5 Days tour or customize your tour to Jordan, Enjoy making the perfect honeymoon, summer vacation, classical or history lover journey. From the peaks of Mt. Nebo enjoy an evening under the stars experience a fantastic desert camp of the valleys of the Jordan River. from the desert of Wadi Rum to the coasts of Aqaba our Jordan Travel Packages leaves no stone unturned.
![5 day jordan package 5 day jordan package](https://www.luxorandaswan.com/../../images/160125832101.jpg)
5 day jordan package
Days: 5 tour type: private.
![10 Day Egypt and Jordan Tours 10 Day Egypt and Jordan Tours](https://www.luxorandaswan.com/../../images/160125833102.jpg)
10 Day Egypt and Jordan Tours
Days: 10 tour type: private.
![Jordan Family Holiday Package Jordan Family Holiday Package](https://www.luxorandaswan.com/../../images/160125834003.jpg)
Jordan Family Holiday Package
Days: 8 tour type: family tour.
![8 Day Road from Petra to Cairo 8 Day Road from Petra to Cairo](https://www.luxorandaswan.com/../../images/160125834904.jpg)
8 Day Road from Petra to Cairo
Days: 8 tour type: private.
![Road to Petra, Trip To Jordan Road to Petra, Trip To Jordan](https://www.luxorandaswan.com/../../images/160125835605.jpg)
Road to Petra, Trip To Jordan
![Luxury Jordan Tours Luxury Jordan Tours](https://www.luxorandaswan.com/../../images/160125836506.jpg)
Luxury Jordan Tours
Days: 6 tour type: private.
![Jordan and Jerusalem Express Tour Jordan and Jerusalem Express Tour](https://www.luxorandaswan.com/../../images/159736157015f35cc8e57923.jpg)
Jordan and Jerusalem Express Tour
![Jordan & Jerusalem Tour Package Jordan & Jerusalem Tour Package](https://www.luxorandaswan.com/../../images/15975798330stock-photo-72715393.jpg)
Jordan & Jerusalem Tour Package
Why travel with luxor and aswan travel, 100% tailor made.
Your entire vacation is designed around your requirements
Explore your interests at your own speed
Select your preferred style of accommodations
Create the perfect trip with the help of our specialists
Expert knowledge
All our specialists have traveled extensively or lived in their specialist regions, We're with you every step of the way
The same specialist will handle your trip from start to finish
Make the most of your time and budget
The best guides
Make the difference between a good trip and an outstanding one
Our leaders will be there to ensure your safety and wellbeing is the number one priority.
Offering more than just dates and names, they strive to offer real insight into their country
Fully protected
24/7 emergency support while abroad
Secure Payment Use your debit card or credit card. Your transactions are protected by 3D Secure and SecureCode.
![jordan travel packages from dubai Cybersource Flag](https://www.luxorandaswan.com/flags/cybersource.png)
Our travel experts are on hand to help!
Get in touch.
Luxor and Aswan Travel best travel agency in Egypt specialized in providing professional advice on planning Travel Packages, Nile Cruises and Day Tours.
- Mohamed Sharkawy-Hilton St., Al Karnak, Luxor, Egypt
- +1 (917) 267-8628
- +201004880015
- [email protected]
Destinations
- African Safari
- About Luxor and Aswan Travel
- Why Luxor and Aswan Travel
- Terms and Conditions
- Privacy Policy
- Travel Tips
Tripadvisor 2024 Travelers' Choice Award
© 2023 Copyright to Luxor and Aswan Travel
![jordan travel packages from dubai jordan travel packages from dubai](https://www.luxorandaswan.com/photos/cards.png)
- Hi, My Account Subscriptions --> My KT Trading Contact Us Privacy Notice Sign Out
Mon, Aug 12, 2024 | Safar 8, 1446
Dubai 20°C
- Expo City Dubai
- Emergencies
- Ras Al Khaimah
- Umm Al Quwain
Life and Living
- Visa & Immigration in UAE
- Banking in UAE
- Schooling in UAE
- Housing in UAE
- Ramadan 2024
- Saudi Arabia
- Philippines
- Cryptocurrency
- Infrastructure
- Currency Exchange
- Horse Racing
- Local Sports
Entertainment
- Local Events
Dubai World Cup
- Track Notes
- Big Numbers
- Daily Updates
- Arts & Culture
- Mental Health
- Relationships
- Staycations
- UAE Attractions
- Tech Reviews
- Motoring Reviews
- Movie Reviews
- Book reviews
- Restaurant Reviews
- Young Times
Supplements
- Back To School
- Eid-Al-Adha
- It’s Summer Time
- Leading Universities
- Higher Education
- India Real Estate Show
- Future Of Insurance
- KT Desert Drive
- New Age Finance & Accounting Summit
- Digital Health Forum
- Subscriptions
- UAE Holidays
- Latest News
- Prayer Timings
- Cinema Listings
- Inspired Living
- Advertise With Us
- Privacy Notice
KT APPDOWNLOAD
![jordan travel packages from dubai Read next article - Khaleej Times](https://static.khaleejtimes.com/wp-content/uploads/sites/2/2024/05/15185234/down-arrow-01.png)
Al Bandar Arjaan unveils staycation packages for UAE and GCC residents
Families will find an array of services tailored to enhance their stay.
![jordan travel packages from dubai jordan travel packages from dubai](https://www.khaleejtimes.com/images/author-pic2.jpg)
A Staff Reporter
- Follow us on
![jordan travel packages from dubai jordan travel packages from dubai](https://static.khaleejtimes.com/wp-content/uploads/sites/2/2023/07/18134758/follow-us-on-google-news-small.png)
Top Stories
UAE announces 2-month grace period for residence visa violators
UAE announces fee refund for tax service charges from August 1
Paid parking in Dubai: Residents face up to Dh4,000 extra yearly costs when new rates kick in
Published: Sun 11 Aug 2024, 3:01 PM
Al Bandar Arjaan by Rotana, a premier hotel apartment destination in Dubai, has announced staycation packages designed specifically for residents and nationals of the UAE and GCC countries.
Al Bandar Arjaan by Rotana offers spacious, fully-furnished one, two, and three-bedroom apartments. Each residence is equipped with modern amenities, including fully stocked kitchens, living areas, and the latest technology.
Families will find an array of services tailored to enhance their stay. The hotel features dedicated children's play areas babysitting services, and child-friendly dining options. Adults can indulge in a variety of amenities, including multiple dining venues, a state-of-the-art fitness center, and a spa.
Al Bandar Arjaan by Rotana, provides services such as laundry and grocery delivery. The property’s prime location provides easy access to major attractions, shopping destinations, and entertainment hubs across Dubai.
Ayman Ashor, General Manager of Al Bandar Arjaan by Rotana, said: "We are thrilled to offer our UAE and GCC guests an opportunity to enjoy a luxurious and memorable staycation with our new packages. Our goal is to provide families with an exceptional experience that combines comfort, convenience, and value. Whether for a short getaway or an extended visit, our facilities and services are designed to cater to the needs of every guest."
In addition to these offerings, the "Rotana Summer Escape" package provides up to 25% off, with children dining for free on the same meals as their parents, making it an unbeatable choice for family vacations.
Al Bandar Arjaan by Rotana shares five international restaurants with Al Bandar Rotana — Gusto Italian Restaurant, Morgan’s Bar & Restaurant, Salt & Pepper, Vanilla Lobby Lounge and The Deck Pool Lounge, while in-room dining is available around the clock.
More news from Lifestyle
Distorted fingers, ears: how to identify fake ai images online.
As the technologies become more sophisticated, distinguishing deepfakes from genuine media can pose significant challenges, raising concerns about privacy, security, and the potential for abuse in the digital age
lifestyle 4 days ago -->
Crown Private School and Al Zorah Golf Club forge partnership
Collaboration aims to promote sustainability in education
lifestyle 5 days ago -->
Dubai: Lebanese content creator shares emotional account of leaving home amid tensions
Karen Wazen's words captured the essence of the diaspora's perpetual struggle
Up to 40% off on hotels: Why some UAE residents choose staycations over holidays abroad
Residents are bagging money-saving hotel deals, with discounts of up to 40 per cent on rooms and villas
ChatGPT can now talk and listen? New voice mode rolled out
A key focus of this release is to make AI voice interactions feel more natural and human-like, with significantly reduced latency during conversations
Look: Queen Rania shares heartwarming family photos as she welcomes first grandchild Iman
The Jordanian royal took to Instagram to post pictures of the newborn
lifestyle 6 days ago -->
6-hour work day, free childcare: Some UAE firms introduce more ‘parent-friendly’ policies
'Being a parent and excelling at work are not mutually exclusive, but complementary as empowered parents are achievers at their workplace'
UAE: Diagnosed at 8, this teen is transforming lives for children with diabetes
Gen-Z entrepreneur Sophia Sacoor is on a mission to help others with Type 1 Diabetes get access to the healthcare they need
Type your keywords
9 Day Highlights of Jordan Package Tour
![jordan travel packages from dubai Jerash - Roma Ruins Jerash - Jerash & Amman Tour From Amman](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2022/12/Jerash-Amman-Tour-from-Amman-1-scaled.jpg?fit=1024%2C683&ssl=1)
Availability
Important details.
Our 9 Day Highlights of Jordan Package Tour will feature vibrant landscapes, immersive culture, and insight into some of the oldest sites in the world. Experience Jerash’s enchanting wonders teeming this ancient city. Let the vibrant atmosphere of Amman and its famous landmarks – Roman Theatre, Temple of Hercules, and King Abdullah Mosque – leave you breathless. Reach Bethany Beyond the Jordan to see the very same spot where Jesus Christ was baptized. The Umayyad Desert Castles will exceed your expectations and the Madaba’s Byzantine church will leave you transfixed. Join a local Bedouin guide on a Jeep safari tour across Wadi Rum’s desert expanse. Later, uncover the secrets of Petra’s lost city, discover Mount Nebo’s breathtaking landscapes, and relax at the tranquil Dead Sea.
For history buffs who love touring ancient sites, this captivating 9 Day Highlights of Jordan Package Tour is perfect for you. Join a Bedouin guide as you cruise Wadi Rum in a Jeep, wander ancient landmarks like the Temple of Hercules, and discover the secrets of Petra’s lost city. This incredible tour includes air-conditioned transportation, expert guides, entrance fees, and 8 nights of accommodations. Book your adventure today!
9 Day Highlights of Jordan Package Tour Highlights
- Discover the ancient ruins of Jerash, a site teeming with archaeological ruins which have withstood the test of time
- See Amman’s famous landmarks such as the Roman Theater, Temple of Hercules, and King Abdullah Mosque
- Browse our list of luxurious Amman hotels and choose your very own accommodations
- Explore the sites and destinations of Jordan with experienced, local experts and gain fantastic insight throughout
- Take a Jeep safari tour with a local Bedouin guide and see Wadi Rum’s terrain like never before
- Relish in the breathtaking vistas of Mount Nebo and learn all about its remarkable Biblical significance
- Actualize your dream of floating on the Dead Sea, take advantage of its rich mud-minerals, and relax in tranquility
- Enjoy the rich history of Bethany Beyond the Jordan and be amazed at the surrounding nature
9 Day Highlights of Jordan Package Tour Itinerary
- After arriving in Amman, spend some free time getting acclimated, relaxing after your flight, and enjoying the local Jordanian atmosphere
- Overnight in Amman
- (Airport transfer is available if pick-up at the airport is selected)
- Pick up from Amman
- Discover the ancient ruins of Jerash which have stood for thousands of years
- Eat lunch in the ancient city (included)
- Tour Amman's ancient sites, like the Temple of Hercules, the Roman Theater, and King Abdullah Mosque
- Explore the modern-day capital of Jordan, diverse and bustling with life
- Pick up from a centralized location in Amman
- Visit the famous baptism site where Jesus was baptized by John
- Explore the nature reserve around the site
- Explore three of the best-preserved desert castles. Qasr al-Kharaneh is the largest and most extravagantly decorated Umayyad castle in Jordan, featuring a large, square fortress surrounded by walls with circular towers on each side. Qusayr Amra boasts vibrant frescoes covering its interior walls and ceilings, and two of its rooms are adorned with colorful mosaics. Lastly, the majestic Qasr al-Azraq, constructed from black basalt.
- Pick up from centralized locations in Amman
- Transfer to Wadi Rum
- Check in to a Bedouin camp in Wadi Rum. Enjoy free time in Wadi Rum. Optional activities can be arranged on the spot including camel rides, hiking, and more
- Jeep safari tour in Wadi Rum with your local Bedouin guide
- Authentic Jordanian Dinner at the Bedouin camp including traditional Zarb (Bedouin barbecue), spreads, salads, bread, and more
- Stay overnight in a glamping style Bedouin camp and taste the delicious traditional food (dinner included)
- Optional sunset camel ride and stargazing experience
- Optional early camel ride at sunrise
- Breakfast at leisure in the Bedouin campsite
- Transfer to Petra including a view of Mount Haroun
- Arrive in Petra and begin your guided tour of the famous sites such as Siq, the Petra Treasury, the Obelisk Tomb, the Calligraphy, Jabal Madbach (sacrificial palace), the Tombs, the Theater, and the Mountaintop Tombs; this guided tour will be approximately 2 hours
- Lunch in a local restaurant
- After a day full of exploring you will head back to Amman
- Enjoy a free day in Amman to explore the city
- Arrive at Madaba and visit the Byzantine church and marvel at the stunning mosaics
- Take in the breathtaking views from the top of Mount Nebo. On clear days, you will be able to see until Jericho on the other side of the river bank
- Arrive at the Dead Sea and relax at the beach
- Apply the therapeutic mud for some skincare and experience the feeling of floating in the special waters of the Dead Sea
- Departure day
- Enjoy a free day to explore at your leisure
- Airport transfer is available if drop-off at the airport is selected
If you have any questions about our 9 Day Highlights of Jordan Package Tour, please contact us. Our team is standing by and will be happy to help
Available dates are shown in green along with the starting price for that date based on recent searches. Click on a date to move to the next step and customize your trip such as adding airport transfers, choosing your hotel, and adding extra nights.
Related Tours and Experiences
![jordan travel packages from dubai Petra](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2022/06/shutterstock_515808439-scaled.jpg?fit=500%2C334&ssl=1)
9 Day Christian Jordan & Israel Tour Package
![jordan travel packages from dubai Tomb - Petra 1 Day Tour Starting In Petra](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2023/01/Petra-1-Day-Tour-starting-in-Petra-6-scaled.jpg?fit=500%2C265&ssl=1)
9 Day Best of Jordan and Israel Tour Package
![jordan travel packages from dubai Jerash & Amman Tour From Amman 1](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2022/12/Jerash-Amman-Tour-from-Amman-4-scaled.jpg?fit=500%2C333&ssl=1)
3 Day Northern Jordan Tour Package
![jordan travel packages from dubai Wadi,rum,,jordan.,kharaz,rock,bridge,world,wonder,in,valley](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2022/06/shutterstock_1936881169-scaled.jpg?fit=500%2C334&ssl=1)
10 day Ultimate Jordan Tour Package
![jordan travel packages from dubai Riyadh Travel Scaled](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2020/09/Riyadh-Travel-scaled.jpg?fit=500%2C363&ssl=1)
10 Day Jordan, Dubai and Abu Dhabi Package Tour
![jordan travel packages from dubai Aqaba](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2022/05/shutterstock_1023056278-1-scaled.jpg?fit=500%2C191&ssl=1)
4 Day Aqaba Holiday Tour Package
![jordan travel packages from dubai 10 Day Secrets Of The United Arab Emirates Jordan Tour Package](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2021/11/10-Day-Secrets-of-the-United-Arab-Emirates-Jordan-Tour-Package.jpg?fit=500%2C252&ssl=1)
10-Day Secrets of the United Arab Emirates & Jordan Tour Package
![jordan travel packages from dubai Wadi Rum,jordan](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2023/02/shutterstock_720482098-scaled.jpg?fit=500%2C237&ssl=1)
5 Day Highlights of Jordan Package Tour
![jordan travel packages from dubai Bethany Beyond The Jordan Tour](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2023/04/Greek-Orthodox-Church-of-John-the-Baptist-in-the-Baptism-Site-Bethany-Beyond-the-Jordan.jpg?fit=500%2C335&ssl=1)
Highlights of Jordan 6 Day Tour Package
![jordan travel packages from dubai Umayyad Desert Castles](https://i0.wp.com/www.touristjordan.com/wp-content/uploads/2023/04/shutterstock_210362797-scaled.jpg?fit=500%2C340&ssl=1)
4 Day Best of Jordan Tour Package
10 all-inclusive hotel deals in the UAE to check out
Make the most of the summer….
There are plenty of benefits to booking an all-inclusive package when you’re planning a getaway. Firstly, no nasty surprises when the bill comes at the end of your stay – because everything is included. Secondly, hello unlimited food and drink – it’s basically like an all-day brunch. Thirdly, some packages also come with added benefits such as complimentary water sports or spa access – perfect for those after a little pampering.
While the UAE might not be very well known for all-inclusive deals, they can be found if you know the right hotels to book.
Here are nine hotels offering all-inclusive packages in the UAE.
FIVE Palm Jumeirah
When you check-in to popular party hotel FIVE Palm Jumeirah, there’s the option to upgrade your board basis to the all-inclusive package. From Dhs1,279 for two per night (plus taxes), guests can enjoy three meals per day, free-flowing drinks at an array of restaurants, access to five swimming pools, a private stretch of beach and 24-hour gym.
FIVE Palm Jumeirah, Palm Jumeirah, Dubai, from Dhs3,054 plus taxes. fivehotelsandresorts.com
The swanky new FIVE address on JBR is offering guests the option to enjoy an all-inclusive rates from Dhs1,480. The resort has some stunning dining options including Playa Pacha, Paradiso and of course the homegrown Goose Island Tap House. The best part is that even if you book into FIVE Luxe you can also visit any of the other properties and enjoy all-inclusive too.
FIVE Luxe, JBR, from Dhs1,480. fivehotelsandresorts.com
JA The Resort
At JA The Resort on the outskirts of the city, guests can check-in to one of three hotels, enjoy dining across 25 restaurants and bars, plus try out myriad activities. All three hotels: JA Lake View, JA Beach Hotel and JA Palm Tree Court offer all-inclusive packages, that allow guests to stay, dine and play across the sprawling resort. With a stay at JA Lake View, prices start from Dhs1,692 and invite guests to enjoy activities from swimming with horses and padel to soothing spa treatments and invigorating watersports. At JA Beach Hotel, rates start from Dhs1,808, with all 200 rooms benefitting from views of the Arabian Gulf, private Marina and lush hotel gardens. JA Palm Tree Court, home to a collection of newly upgraded villas, welcomes guests to enjoy all-inclusive stays with rates from Dhs2,016, and features over 200 beachfront villa suites, beach cabanas and a newly built private swimming pool plus a water park for the little ones.
JA The Resort, Jebel Ali, Dubai, from Dhs1,692. Tel: (0)4 814 5500, jaresortshotels.com
One of the most affordable options on the list, Riu Dubai is an all-inclusive hotel at Dubai Islands (formerly Deira Islands). The four-star resort features various themed restaurants, a water park, three swimming pools and a spa, making it a welcome choice for families looking for a wallet-friendly getaway with something for everyone. Best of all, the all-inclusive option is available 24-hours, so you can be sure to get what you want, whatever hour of the day. The resort has dry (meals only) packages from Dhs3,869 per room per night for two.
Riu Dubai, Deira Islands, Dubai, from Dhs3,869 per night. riu.com
Al Maha desert resort and spa
If you are looking for a genuine escape from the city, then this is the one for you. This stunning desert escape is a luxurious and beautiful way to relax and unwind. Sip poolside and watch as camels and oryx roam around your private tent. Inclusive of all of your meals and two selected activities, the packages start from Dhs6,382 per person, per night.
Al Maha, Dubai Desert Conservation Reserve, from Dhs6,382 per person per night. marriott.com
Rixos The Palm
Want to enjoy an all-inclusive stay without leaving Dubai? Then check yourself into Rixos The Palm. Found on the tip of the East Crescent of the Palm Jumeirah, Rixos The Palm offers their standard all-inclusive packages on all room types, as well as the ‘Ultra All-Inclusive’ package. This gives guests access to unlimited food and drink across all restaurants and bars as well as access to a variety of water sports, daily entertainment activities, wellness facilities at the Turkish-inspired Anjana Spa as well as minibar service daily. Rates start from Dhs3,108 per room for a minimum of two nights.
Rixos The Palm, Palm Jumeirah, Dubai, from Dhs3,108 per room. thepalmdubai.rixos.com
Anantara Sir Bani Yas Island
The picturesque island of Sir Bani Yas has it all: beautiful nature, fantastic wildlife, sugary beaches… plus three Anantara Resorts all of which offer all-inclusive packages. There’s the family-friendly Desert Islands Resort, then a duo of all-villa resorts called Al Yamm and Al Sahel. You can book all-inclusive which includes your breakfast, lunch and dinner, or ultra all-inclusive which comes with unlimited house beverages, too. Prices start from Dhs1,500.
Anantara Sir Bani Yas, Sir Bani Yas Island, Abu Dhabi. anantara.com
Rixos Premium Saadiyat Island
Rixos Premium Saadiyat in Abu Dhabi is stunning, and the premium all-inclusive package at this UAE hotel ensures literally everything is included. As well as all-inclusive food and drink, guests can also take advantage of daily yoga, cycling, paddle boarding and complimentary access to the tennis courts. Think light airy bedrooms, opulent interiors and a lagoon-sized swimming pool that all open up onto a private stretch of Saadiyat Island’s enviable white beachfront. For most dates, a minimum two-night stay is required, with nightly rates from Dhs2,430 for a minimum of two nights.
Rixos Premium Saadiyat Island, Saadiyat Island, Abu Dhabi, from Dhs2,430. saadiyatisland.rixos.com
Ras Al Khaimah
Cove rotana.
Among the more affordable hotels in the UAE that offers all inclusive is the Cove Rotana, set within its own peaceful inlet on a hillside that leads down to the white sandy beach. The 349 stylish rooms are all arranged to look like an Arabian village, and among them you’ll find a collection of 43 private villas with one-, two-, or three-bedrooms, ideally for big group getaways. Each comes with all the modern amenities you’d expect, separate living spaces, and some even offer their own private pools. For dining, there’s a choice of seven culinary experiences from the chilled-out pool bar and sunset cafe, to the all-day dining restaurant, Cinnamon; and signature Mediterranean restaurant, Basilico. You’ll also have access to two infinity pools, a private beach and a spa with four treatment rooms. Room rates start from Dhs614 per night for the all-inclusive package.
Cove Rotana, Sheikh Muhammad Bin Salem Rd, Ras Al Khaimah, from Dhs614. rotana.com
Rixos Bab Al Bahr
A stalwart on the all-inclusive hotel scene in the UAE is Rixos Bab Al Bahr. At Rixos Bab Al Bahr, guests can indulge in a variety of restaurants and everything is inclusive from the kaleidoscope of cuisine in Seven Heights and the selection of unlimited beverages in See & Sea and Mojito Lounge. Away from food and drink, staycationers can expect entertainment and nightlife, kids clubs, a spa, sports, and recreational activities all included. Room rates start from Dhs1,512 for a minimum of two nights.
Rixos Bab Al Bahr, Al Marjan Island, Ras Al Khaimah, room rates from Dhs1,512. babalbahr.rixos.com
![](http://playon.fun/777/templates/cheerup/res/banner1.gif)
IMAGES
COMMENTS
4 Nights. 5 Nights. 2 Option. Al Qasr Metropole Hotel. Conveniently located in Shmeisani one of the most central business districts in Amman. Package includes: Direct flights from Dubai to Amman with Royal Jordanian with 20 kg check in luggage. Hotel stay in Amman with daily breakfast. Holiday Factory representative.
Best Jordan Holiday Packages from UAE - Get amazing deals on Jordan tour packages at Travelwings.com. Explore best of Jordan with our vacation packages & book a customised holiday package for an unforgettable memory +971-45635811; CONTACT US; EN | AED ... You can take a direct flight from Dubai, Sharjah and Abu Dhabi. The average travel time of ...
Our 8 Day Ultimate Jordan Package Tour provides a comprehensive tour package of the Kingdom of Jordan. Available with guaranteed departures every week, this is a package tour including all touring, guiding, transportation, overnight accommodation, airport assistance and transfers. The itinerary of our 8 Day Ultimate Jordan Tour includes all the ...
Package Inclusions: Return Economy class flights on award winning Emirates. 6 nights' accommodation in 4-star hotels. Return airport transfers by private car. Meals, transfers and guided sightseeing tours as specified in the itinerary. Entrance fees to Petra. English speaking Local guide at Petra (from the Visitors Centre up to Qaser el Bint)
Book our all-inclusive 05 Days Jordan tour packages from Dubai. Jordan is one of the Middle East's safest and most forward-thinking nations. Due to its ancient legacy, the nation has been nicknamed "an open-air museum.". It also features a gorgeous natural landscape and a coastline, as well as outstanding Middle Eastern food and kind ...
Cheap holiday packages in Amman from United Arab Emirates. View all. King Faisal Street - Down Town11118. Mansour Hotel. 2-star hotel. 3 Nights. Flights included. AED 1,502. per person.
Welcome to 5 days and 4 Nights Jordan with AFC Holidays. This tour will truly make a memory of a lifetime, blessed with stunning World Heritage Sites, and otherworldly desert landscapes flushed pink and white. Traverse the King's highway and pass through city after city, learning of the significant ancient stories and cultures.
9 Nights 10 Days Jordan Leisure Tour Package. Experience the best of Jordan with the leisure tour package. Travel from the north to the south and enjoy the beautiful highlights of Jordan. Walk through the ancient rubbles and pathways, embrace the beauty of the deserts, and feel the warm welcome of the Jordanian people. Hotel included in package.
Weather in. August. 20 to 32 ºC. Subscribe. Jordan Holiday Packages - Book Your Jordan Tour Package with Holidays by flydubai. Visit Jordan and immerse yourself in its stunning landscapes and amazing ancient ruins.
Embark on a captivating journey from Dubai to Jordan with our curated Jordan holiday packages from Dubai. Explore the vibrant culture of the city. +971 56 216 5581 HOTLINE. About Us; Travel Insurance; Home; About Us; Holidays; Summer Tours; Visa; Dubai Attraction ... Go kite Travel and Tours LLC (Head Office) ACICO Business Park Building ...
TravTips offers best holiday deals on Jordan in a Nutshell tour packages from Dubai & Abu Dhabi. Book your holiday packages @TravTips. Book Now! +971 4 5642254 +971 4 3577770; Book Online; Blog; ... customer-centric, innovative fastest growing leisure travel company in the UAE-GCC region comprising of both consumer and business- to- business ...
JORDAN PACKAGE INCLUSIONS. Economy class return air ticket with airport taxes; ... Pandemic Coverage Travel Insurance; FLIGHT DETAILS - Fly Dubai. FZ 143 DUBAI AMMAN 1920 2135. FZ 144 AMMAN DUBAI 2235 0235 . TERMS & CONDITIONS. Price doesn't include any other services not mentioned. This offer can be withdrawn anytime without any prior ...
The order of days is subject to change and will be reflected on your itinerary provided before travel. Detailed information regarding pick up locations will be provided in your confirmation email. Please note that the hotels are subject to availability. $1,346 /person. Embark on our 10 Day Ultimate Jordan Tour Package, leading you across ...
The tours to Jordan from Dubai depart daily of more than 6 flights from Dubai International Airport to Amman. The flights are for less than 3 hours and offer a great value and great comfort. In Amman, you will meet With various Jordan Tours available in the Amman arrival. The tours of Jordan can even be arranged directly from Dubai then in ...
Our 10 Day Jordan, Dubai and Abu Dhabi Package Tour takes you on an intimate and immersive tour across the sands of the Middle East, from modern metropolises to deserted ruins in the vast desert. ... Book Direct with Jordan's Leading Travel Company Friendly Customer Service 7 Days a Week Hand Picked Guides & Tour Leaders The Best Price ...
Jordan, a jewel in the Middle East, offers a captivating blend of history, culture, and natural wonders. The rose-red city of Petra, an archaeological marvel, stands as a testament to ancient civilizations, inviting exploration through its intricate rock-cut architecture. Jordan's cultural heritage spans millennia.
Meet and assist at Amman Airport upon Arrival & departure. Sightseeing in modern air-conditioned private transfer. Entrance fees to all sites mentioned at the excursion. Local English Speaking Guide at Petra for 02 - 03 Hours only. Return airport transfers on a private basis. Applicable taxes. Air Ticket.
17 Day Crown of Egypt with 4 Day First Class Nile Cruise & Jordan, February 2023. Our 2nd trip to Egypt with Gate1, but with the addition of Jordan this time. What an amazing trip! Our tour manager in Egypt, Tarek, was absolutely and simply the best tour manager we've EVER had on all our trips.
Tips for finding Jordan package deals. There are loads of types of vacations in Jordan and the cost will depend on what type of trip you're taking and for how long you'd like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $412; Family vacation $320; Romantic vacation $503; Luxury vacation $544.
Run: Everyday. From the Old City of Amman to Petra's sprawling ruins, enjoy 5 days full of natural wonders in Jordan! You will start your Road to Petra tour from Amman. Enjoy a 5-day itinerary discovering the ancient Jordan highlights and Roman ruins. Visit the rose-red city of Petra which is the biggest attraction in Jordan; Jerash, situated ...
On our 4 Day Best of Jordan Tour Package, be transfixed by Petra's ancient wonders, Wadi Rum's rugged desert, and Amman's incredible sites.Begin in Jerash - the Roman city adorned with archeological treasures of years past. Explore the rich culture of Amman, walk the modern streets, and see the towering Temple of Hercules, among other famous landmarks.
Days: 10 Tour type: Private. Experience a marvelous 9-night Jordan Egypt Travel Package discovering Egypt, enjoying 5-star accommodation with a panoramic view of the river Nile through Luxor and Aswan. View Trip. from $1679.
Al Bandar Arjaan by Rotana, a premier hotel apartment destination in Dubai, has announced staycation packages designed specifically for residents and nationals of the UAE and GCC countries.
Ask a Question Book Now. Our 9 Day Highlights of Jordan Package Tour will feature vibrant landscapes, immersive culture, and insight into some of the oldest sites in the world. Experience Jerash's enchanting wonders teeming this ancient city. Let the vibrant atmosphere of Amman and its famous landmarks - Roman Theatre, Temple of Hercules ...
Here are nine hotels offering all-inclusive packages in the UAE. Dubai FIVE Palm Jumeirah. ... Riu Dubai, Deira Islands, Dubai, from Dhs3,869 per night. riu.com. Al Maha desert resort and spa.